Actix Web
Web Framework · Since 2017
A powerful, pragmatic Rust web framework that consistently tops web framework benchmarks while keeping type-safe, ergonomic APIs.
- Created by
- Nikolay Kim
- Language
- Rust
- License
- MIT / Apache-2.0
- Alternative to
- Axum, Rocket, Gin
Use cases
- Extreme-performance APIs
- Low-latency services
- Memory-safe backends
- Streaming endpoints
Alpine.js
Frontend · Since 2019
A rugged, minimal framework for composing behavior directly in your HTML markup — jQuery-era simplicity with modern reactive declarative syntax.
- Created by
- Caleb Porzio
- Language
- JavaScript
- License
- MIT
- Alternative to
- jQuery, Stimulus
Use cases
- Dropdowns, modals & toggles
- Server-rendered app interactivity
- Laravel/Rails frontends
- Landing pages
javascriptlightweighthtml-firstsprinkles
Angular
Frontend · Since 2016
Google's batteries-included TypeScript framework with routing, forms, dependency injection, and testing built in — a complete platform for large applications.
- Created by
- Google, Miško Hevery
- Language
- TypeScript
- License
- MIT
- Alternative to
- React, Vue.js
Use cases
- Enterprise web apps
- Large team codebases
- Internal business tools
- Complex forms & workflows
typescriptframeworkspaenterprise
Anki
Office & Productivity · Since 2006
The spaced-repetition flashcard system that medical students swear by — scientifically scheduled reviews that move knowledge into long-term memory.
- Created by
- Damien Elmes
- Language
- Rust / Python
- License
- AGPLv3
- Alternative to
- Quizlet, RemNote, SuperMemo
Use cases
- Language vocabulary learning
- Medical & law exam prep
- Programming concept retention
- Long-term memorization
flashcardsspaced-repetitionlearningmemory
Ansible
DevOps & Infrastructure · Since 2012
Agentless IT automation — describe server configuration in YAML playbooks and Ansible applies it over SSH, no software needed on the target machines.
- Created by
- Michael DeHaan
- Language
- Python
- License
- GPLv3
- Alternative to
- Chef, Puppet, SaltStack
Use cases
- Server provisioning
- Configuration management
- Application deployment
- Patch orchestration
automationconfiguration-managementyamlagentless
Apache Airflow
Data Science · Since 2015
The standard for orchestrating data pipelines — define workflows as Python DAGs with scheduling, retries, backfills, and a rich monitoring UI.
- Created by
- Maxime Beauchemin, Airbnb
- Language
- Python
- License
- Apache-2.0
- Alternative to
- Dagster, Prefect, cron scripts
Use cases
- ETL/ELT orchestration
- Scheduled data workflows
- ML pipeline scheduling
- Cross-system job dependencies
orchestrationdata-pipelinespythonscheduling
Apache Cassandra
Database · Since 2008
A masterless, wide-column NoSQL database built for massive scale and zero downtime — writes stay fast across data centers even when nodes fail.
- Created by
- Avinash Lakshman, Prashant Malik, Facebook
- Language
- Java
- License
- Apache-2.0
- Alternative to
- ScyllaDB, DynamoDB, HBase
Use cases
- Massive write-heavy workloads
- Multi-datacenter replication
- Time-series at scale
- Always-on global services
nosqlwide-columndistributedhigh-availability
Apache CouchDB
Database · Since 2005
A document database that speaks HTTP and JSON natively, famous for its multi-master replication that makes offline-first apps sync seamlessly.
- Created by
- Damien Katz
- Language
- Erlang
- License
- Apache-2.0
- Alternative to
- MongoDB, Couchbase
Use cases
- Offline-first apps (with PouchDB)
- Mobile data sync
- Distributed document storage
- Edge replication
nosqldocument-storereplicationoffline-first
Apache Kafka
DevOps & Infrastructure · Since 2011
A distributed event streaming platform that handles trillions of events per day — the backbone of event-driven architectures and real-time data pipelines.
- Created by
- Jay Kreps, Neha Narkhede, Jun Rao, LinkedIn
- Language
- Java / Scala
- License
- Apache-2.0
- Alternative to
- RabbitMQ, Redpanda, Pulsar
Use cases
- Event streaming
- Log aggregation pipelines
- Microservice communication
- Change data capture
streamingmessage-brokerdistributedevent-driven
Apache Spark
Data Science · Since 2010
The unified engine for large-scale data processing — in-memory distributed computation with APIs for SQL, streaming, and machine learning across clusters.
- Created by
- Matei Zaharia, UC Berkeley AMPLab
- Language
- Scala
- License
- Apache-2.0
- Alternative to
- Hadoop MapReduce, Flink, Dask
Use cases
- Big data ETL
- Distributed SQL analytics
- Stream processing
- Large-scale ML (MLlib)
big-datadistributed-computingetlanalytics
Apache Superset
Data Science · Since 2016
A modern, enterprise-grade business intelligence platform — explore data with a no-code chart builder or SQL IDE and assemble interactive dashboards.
- Created by
- Maxime Beauchemin, Airbnb
- Language
- Python / TypeScript
- License
- Apache-2.0
- Alternative to
- Tableau, Metabase, Looker
Use cases
- Self-hosted BI dashboards
- SQL-based data exploration
- Embedded analytics
- Replacing Tableau/PowerBI
business-intelligencedashboardsvisualizationsql
Appwrite
Self-Hosted · Since 2019
A self-hosted backend-as-a-service — authentication, databases, storage, and serverless functions behind one API, for web, mobile, and Flutter apps.
- Created by
- Eldad Fux
- Language
- PHP / TypeScript
- License
- BSD-3-Clause
- Alternative to
- Firebase, Supabase, PocketBase
Use cases
- App backends without boilerplate
- Auth & user management
- Flutter/mobile backends
- Serverless functions
Argo CD
DevOps & Infrastructure · Since 2018
The declarative GitOps continuous delivery tool for Kubernetes — your Git repo is the source of truth, and Argo keeps the cluster synced to it.
- Created by
- Intuit (Argo team)
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Flux, Spinnaker, Jenkins X
Use cases
- GitOps deployments
- Multi-cluster app delivery
- Automated drift detection
- Progressive rollouts
gitopskubernetescontinuous-deliverydeclarative
Astro
Frontend · Since 2021
A web framework for content-driven sites that ships zero JavaScript by default — interactive 'islands' hydrate only where needed, from any UI framework.
- Created by
- Fred K. Schott
- Language
- TypeScript
- License
- MIT
- Alternative to
- Next.js (content sites), Gatsby, Hugo
Use cases
- Blogs & documentation sites
- Marketing pages
- Content-heavy sites with minimal JS
- Mixing React/Vue/Svelte components
javascriptstatic-siteislands-architecturecontent-sites
Audacity
Creative & Media · Since 2000
The world's most popular audio editor — multi-track recording and editing, noise reduction, and effects, trusted by podcasters for two decades.
- Created by
- Dominic Mazzoni, Roger Dannenberg
- Language
- C++
- License
- GPLv3
- Alternative to
- Adobe Audition, GarageBand, Reaper
Use cases
- Podcast recording & editing
- Audio cleanup & noise removal
- Music digitization
- Voice-over production
audio-editingrecordingpodcastingmulti-track
Blender
Creative & Media · Since 1998
A complete free 3D creation suite — modeling, sculpting, animation, VFX, and rendering. Used on Oscar-nominated films and by millions of hobbyists.
- Created by
- Ton Roosendaal
- Language
- C / C++ / Python
- License
- GPLv3
- Alternative to
- Maya, 3ds Max, Cinema 4D
Use cases
- 3D modeling & animation
- Game asset creation
- Motion graphics
- Architectural visualization
Bootstrap
Frontend · Since 2011
The original responsive CSS framework — a ready-made grid system and component library that defined how the web looked for a decade.
- Created by
- Mark Otto, Jacob Thornton, Twitter
- Language
- JavaScript / SCSS
- License
- MIT
- Alternative to
- Tailwind CSS, Bulma, Foundation
Use cases
- Admin dashboards
- Rapid prototypes
- Internal business tools
- Consistent responsive layouts
csscomponentsresponsivegrid-system
An all-in-one JavaScript runtime, bundler, test runner, and package manager written in Zig — dramatically faster startup and installs than Node.js.
- Created by
- Jarred Sumner
- Language
- Zig
- License
- MIT
- Alternative to
- Node.js, Deno
Use cases
- Fast package installs
- TypeScript execution without config
- Test running
- Drop-in Node.js replacement
javascripttypescriptruntimeperformance
Caddy
DevOps & Infrastructure · Since 2015
The web server with automatic HTTPS — provisions and renews TLS certificates by default, with a config file simple enough to memorize.
- Created by
- Matt Holt
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Nginx, Traefik, Apache
Use cases
- Zero-config HTTPS serving
- Reverse proxy for apps
- Static site hosting
- Self-hosted service gateway
web-serverautomatic-httpsreverse-proxysimple-config
Certbot
Security · Since 2015
The EFF's official Let's Encrypt client — fetch and automatically renew free TLS certificates, the tool that helped encrypt most of the web.
- Created by
- Electronic Frontier Foundation
- Language
- Python
- License
- Apache-2.0
- Alternative to
- acme.sh, Caddy (built-in), lego
Use cases
- Free HTTPS certificates
- Automatic cert renewal
- Nginx/Apache TLS setup
- Wildcard certificates (DNS)
tlslets-encryptcertificatesautomation
Chromium
Browser · Since 2008
The open source browser project behind Chrome, Edge, Brave, and Opera — its Blink engine and V8 JavaScript engine define how most of the web runs.
- Created by
- Google
- Language
- C++
- License
- BSD-3-Clause
- Alternative to
- Firefox (Gecko), WebKit
Use cases
- Browser development base
- Headless testing (Puppeteer)
- Embedded browsers (Electron/CEF)
- Web standards implementation
web-browserblinkv8browser-engine
ClickHouse
Database · Since 2016
A blazing-fast columnar database for real-time analytics — scans billions of rows per second, originally built to power Yandex's web analytics.
- Created by
- Alexey Milovidov, Yandex
- Language
- C++
- License
- Apache-2.0
- Alternative to
- BigQuery (self-hosted), Druid, Pinot
Use cases
- Real-time analytics dashboards
- Log & event analytics
- Observability data stores
- Ad-tech reporting
ComfyUI
AI & Machine Learning · Since 2023
A node-based interface for image and video generation models — wire together diffusion pipelines visually, with full control over every step.
- Created by
- comfyanonymous
- Language
- Python
- License
- GPLv3
- Alternative to
- AUTOMATIC1111 WebUI, Midjourney (self-hosted)
Use cases
- AI image generation workflows
- Stable Diffusion pipelines
- AI video generation
- Reproducible generative art
image-generationstable-diffusionnode-basedworkflows
curl
Developer Tools · Since 1998
The command-line tool and library for transferring data with URLs — installed on an estimated 20 billion devices, from servers to cars to Mars rovers.
- Created by
- Daniel Stenberg
- Language
- C
- License
- curl License (MIT-style)
- Alternative to
- wget, HTTPie, Postman (CLI)
Use cases
- API testing from the terminal
- Scripted downloads
- HTTP debugging
- Embedded data transfer (libcurl)
httpclinetworkingdata-transfer
D3.js
Frontend · Since 2011
Data-Driven Documents — the foundational library for bespoke, interactive data visualizations, binding data to the DOM with full creative control.
- Created by
- Mike Bostock
- Language
- JavaScript
- License
- ISC
- Alternative to
- Chart.js (simple charts), ECharts, Plotly
Use cases
- Custom interactive charts
- Data journalism graphics
- Network & tree diagrams
- Geographic maps
data-visualizationsvgchartsjavascript
dbt
Data Science · Since 2016
The tool that created analytics engineering — transform warehouse data with version-controlled, tested, documented SQL models instead of fragile scripts.
- Created by
- Tristan Handy, Fishtown Analytics
- Language
- Python
- License
- Apache-2.0
- Alternative to
- SQLMesh, hand-rolled SQL scripts
Use cases
- Data warehouse transformations
- Data quality testing
- Analytics documentation
- ELT modeling layers
analytics-engineeringsqldata-transformationtesting
Debian
Operating System · Since 1993
The universal operating system — a fully community-governed Linux distribution whose legendary stability makes it the base of Ubuntu, Mint, and countless servers.
- Created by
- Ian Murdock
- Language
- C / multiple
- License
- DFSG-free (GPL and others)
- Alternative to
- Ubuntu, Fedora, Alpine
Use cases
- Stable production servers
- Base for other distros (Ubuntu)
- Long-term support systems
- Raspberry Pi OS foundation
linux-distributionstabilityaptcommunity
A secure JavaScript and TypeScript runtime from Node.js's original creator — permissions-based sandboxing, built-in tooling, and native TypeScript support.
- Created by
- Ryan Dahl
- Language
- Rust
- License
- MIT
- Alternative to
- Node.js, Bun
Use cases
- Secure scripting
- TypeScript-first backends
- Edge functions (Deno Deploy)
- CLI tools without build steps
typescriptjavascriptruntimesecure-by-default
Discourse
Communication & Social · Since 2013
Civilized discussion for the modern internet — the forum platform with trust levels, great moderation tools, and email integration that communities love.
- Created by
- Jeff Atwood, Robin Ward, Sam Saffron
- Language
- Ruby
- License
- GPLv2
- Alternative to
- phpBB, Discord (async), Reddit (private)
Use cases
- Product community forums
- Open source project discussions
- Support communities
- Q&A knowledge bases
forumcommunitydiscussionsmoderation
Django
Web Framework · Since 2005
The 'batteries-included' Python web framework with an ORM, admin panel, authentication, and security defaults out of the box. Built for perfectionists with deadlines.
- Created by
- Adrian Holovaty, Simon Willison
- Language
- Python
- License
- BSD-3-Clause
- Alternative to
- Ruby on Rails, Laravel
Use cases
- Content-heavy websites
- Admin-driven applications
- Rapid MVP development
- Data-backed platforms (Instagram origins)
pythonormfullstackbatteries-included
Docker
DevOps & Infrastructure · Since 2013
The tool that made Linux containers mainstream — package an app with its dependencies into a portable image that runs identically anywhere.
- Created by
- Solomon Hykes, dotCloud
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Podman, containerd (direct)
Use cases
- Reproducible dev environments
- CI/CD pipelines
- Microservice packaging
- Local service dependencies
containersdevopsdeploymentisolation
The enterprise-grade CMS with deep content modeling and access control — trusted by governments, universities, and media organizations worldwide.
- Created by
- Dries Buytaert
- Language
- PHP
- License
- GPLv2+
- Alternative to
- WordPress, Adobe Experience Manager
Use cases
- Government & university sites
- Complex content architectures
- Multilingual platforms
- Enterprise publishing
phpenterprise-cmscontent-modelinggovernment
DuckDB
Database · Since 2019
The 'SQLite for analytics' — an in-process columnar SQL database that queries Parquet and CSV files at remarkable speed, right from Python or the CLI.
- Created by
- Mark Raasveldt, Hannes Mühleisen, CWI
- Language
- C++
- License
- MIT
- Alternative to
- Pandas (for SQL folk), SQLite (analytics), Spark (small data)
Use cases
- Local data analysis
- Querying Parquet/CSV directly
- Data pipeline transforms
- Notebook analytics
Elasticsearch
Database · Since 2010
A distributed search and analytics engine built on Apache Lucene — the standard for full-text search, log analytics (ELK stack), and observability data.
- Created by
- Shay Banon
- Language
- Java
- License
- AGPLv3 / Elastic License
- Alternative to
- OpenSearch, Meilisearch, Typesense
Use cases
- Site & product search
- Log aggregation (ELK)
- Security analytics (SIEM)
- Vector & hybrid search
searchfull-textanalyticsdistributed
Electron
Desktop · Since 2013
Build cross-platform desktop apps with web technology — Chromium plus Node.js in one runtime. VS Code, Slack, and Discord are all Electron apps.
- Created by
- Cheng Zhao, GitHub
- Language
- C++ / TypeScript
- License
- MIT
- Alternative to
- Tauri, native desktop toolkits
Use cases
- Cross-platform desktop apps
- Web app desktop ports
- Internal desktop tools
- Editor & IDE shells
desktop-appsjavascriptcross-platformchromium
Element (Matrix)
Communication & Social · Since 2016
The flagship client for the Matrix protocol — decentralized, end-to-end encrypted chat where servers federate and no single entity owns the network.
- Created by
- Matthew Hodgson, Amandine Le Pape
- Language
- TypeScript
- License
- AGPLv3
- Alternative to
- Slack, Discord, Signal (groups)
Use cases
- Decentralized team chat
- Government & defense messaging
- Bridged multi-network chat
- Encrypted communities
messagingfederationend-to-end-encryptionmatrix-protocol
ESLint
Developer Tools · Since 2013
The pluggable JavaScript linter — catch bugs and enforce code style with configurable rules, integrated into virtually every serious JS project.
- Created by
- Nicholas C. Zakas
- Language
- JavaScript
- License
- MIT
- Alternative to
- Biome, oxlint, JSHint
Use cases
- Catching bugs before runtime
- Team code style enforcement
- CI quality gates
- Custom rule authoring
lintingjavascriptcode-qualitystatic-analysis
etcd
DevOps & Infrastructure · Since 2013
A strongly consistent, distributed key-value store built on the Raft consensus algorithm — the brain that stores all of Kubernetes' cluster state.
- Created by
- CoreOS (Brandon Philips team)
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Consul, ZooKeeper
Use cases
- Kubernetes cluster state
- Service discovery
- Distributed configuration
- Leader election
key-valuedistributedconsensuskubernetes
Excalidraw
Creative & Media · Since 2020
A virtual whiteboard with a hand-drawn feel — sketch diagrams and wireframes that look friendly, with end-to-end encrypted live collaboration.
- Created by
- Christopher Chedeau (vjeux)
- Language
- TypeScript
- License
- MIT
- Alternative to
- Miro, tldraw, draw.io
Use cases
- Architecture diagrams
- Whiteboard brainstorming
- Blog & docs illustrations
- Wireframe sketches
whiteboarddiagramssketchingcollaboration
The framework and platform that makes React Native productive — file-based routing, cloud builds, over-the-air updates, and instant device preview.
- Created by
- Charlie Cheever, James Ide
- Language
- TypeScript
- License
- MIT
- Alternative to
- Bare React Native, Flutter tooling
Use cases
- React Native development
- Instant mobile prototyping
- OTA app updates
- Cloud iOS builds without a Mac
react-nativedeveloper-experienceota-updatestooling
Express
Web Framework · Since 2010
The minimalist web framework that became the default for Node.js — simple routing and middleware that most of the JavaScript backend ecosystem builds upon.
- Created by
- TJ Holowaychuk
- Language
- JavaScript
- License
- MIT
- Alternative to
- Fastify, Koa, NestJS
Use cases
- REST APIs
- Server-rendered apps
- Middleware pipelines
- Learning backend basics
javascriptnodejsapiminimal
FastAPI
Web Framework · Since 2018
A modern, high-performance Python framework for building APIs with automatic OpenAPI docs, type-hint validation via Pydantic, and native async support.
- Created by
- Sebastián Ramírez
- Language
- Python
- License
- MIT
- Alternative to
- Flask, Django REST Framework
Use cases
- REST APIs & microservices
- ML model serving
- Async backends
- Auto-documented internal APIs
FFmpeg
Creative & Media · Since 2000
The Swiss Army knife of multimedia — decode, encode, transcode, and stream virtually any audio/video format ever created. YouTube and Netflix run on it.
- Created by
- Fabrice Bellard
- Language
- C
- License
- LGPLv2.1 / GPLv2
- Alternative to
- HandBrake (GUI), GStreamer
Use cases
- Video transcoding pipelines
- Format conversion
- Streaming media processing
- Thumbnail & clip extraction
video-processingtranscodingstreamingcli
Firefox
Browser · Since 2004
The independent web browser — the only major browser not built on Chromium, keeping engine diversity and user privacy at the center of the web.
- Created by
- Blake Ross, Dave Hyatt, Mozilla
- Language
- C++ / Rust / JavaScript
- License
- MPL-2.0
- Alternative to
- Chrome, Edge, Safari
Use cases
- Privacy-focused browsing
- Web development testing (Gecko)
- Extension-rich browsing
- Cross-platform sync
web-browserprivacygeckoindependent
Flask
Web Framework · Since 2010
A lightweight Python microframework that gives you routing and templating, then stays out of your way — you choose every other piece of the stack.
- Created by
- Armin Ronacher
- Language
- Python
- License
- BSD-3-Clause
- Alternative to
- FastAPI, Django
Use cases
- Small web services
- Prototypes & teaching
- APIs with custom stacks
- Embedded dashboards
pythonmicroframeworkapiminimal
Flutter
Mobile · Since 2017
Google's UI toolkit for building natively compiled apps for mobile, web, and desktop from a single Dart codebase, with its own high-performance rendering engine.
- Created by
- Google
- Language
- Dart
- License
- BSD-3-Clause
- Alternative to
- React Native, native iOS/Android
Use cases
- Cross-platform mobile apps
- Desktop apps
- Embedded UIs
- MVP apps with one codebase
dartcross-platformui-toolkitnative-compile
FreeBSD
Operating System · Since 1993
A complete Unix-like operating system descended from Berkeley Unix — famed for its network stack and ZFS support, it underpins Netflix's CDN and the PlayStation OS.
- Created by
- Jordan Hubbard, Rod Grimes, David Greenman
- Language
- C
- License
- BSD-2-Clause
- Alternative to
- Linux, OpenBSD
Use cases
- High-performance network servers
- Storage appliances (ZFS)
- Embedded appliances (pfSense)
- Permissive-license OS base
A modern publishing platform focused on professional creators — native newsletters, paid memberships, and a clean editor without plugin sprawl.
- Created by
- John O'Nolan, Hannah Wolfe
- Language
- JavaScript
- License
- MIT
- Alternative to
- WordPress, Substack (proprietary)
Use cases
- Newsletters & paid subscriptions
- Publications & magazines
- Personal blogs
- Creator businesses
nodejspublishingnewslettersmemberships
GIMP
Creative & Media · Since 1996
The GNU Image Manipulation Program — a full-featured image editor with layers, masks, filters, and scripting, free for nearly three decades.
- Created by
- Spencer Kimball, Peter Mattis
- Language
- C
- License
- GPLv3
- Alternative to
- Photoshop, Affinity Photo, Photopea
Use cases
- Photo editing & retouching
- Web graphics
- Image format conversion
- Batch processing (Script-Fu)
image-editingphoto-manipulationgraphicsdesign
Gin
Web Framework · Since 2014
The most popular Go web framework — a martini-like API with radix-tree routing that handles enormous request throughput with minimal overhead.
- Created by
- Manu Martínez-Almeida
- Language
- Go
- License
- MIT
- Alternative to
- Echo, Fiber, chi
Use cases
- High-throughput REST APIs
- Microservices
- Backend for mobile apps
- Internal services
Git
Developer Tools · Since 2005
The distributed version control system Linus Torvalds wrote in two weeks to manage Linux kernel development — now the universal standard for tracking code.
- Created by
- Linus Torvalds
- Language
- C
- License
- GPLv2
- Alternative to
- Mercurial, SVN
Use cases
- Source code versioning
- Team collaboration (GitHub/GitLab)
- Release management
- Open source contribution
version-controldistributedclicollaboration
Gitea
DevOps & Infrastructure · Since 2016
A painless, lightweight self-hosted Git service — GitHub-style repos, pull requests, and CI (Gitea Actions) that runs happily on a Raspberry Pi.
- Created by
- Lunny Xiao, Gogs community
- Language
- Go
- License
- MIT
- Alternative to
- GitLab, GitHub, Forgejo
Use cases
- Lightweight self-hosted Git
- Home lab code hosting
- Private team repositories
- Air-gapped source control
gitself-hostedlightweightcode-hosting
GitLab
DevOps & Infrastructure · Since 2011
A complete DevOps platform in a single application — Git hosting, CI/CD, issue tracking, container registry, and security scanning, self-hostable end to end.
- Created by
- Dmitriy Zaporozhets, Valery Sizov
- Language
- Ruby
- License
- MIT (Community Edition)
- Alternative to
- GitHub, Bitbucket, Gitea
Use cases
- Self-hosted Git & CI/CD
- Enterprise DevOps platform
- Compliance-controlled source hosting
- Integrated issue tracking
gitci-cddevops-platformself-hosted
Godot Engine
Creative & Media · Since 2014
A feature-packed 2D and 3D game engine with a node-based scene system and its own Python-like GDScript — completely free with no royalties, ever.
- Created by
- Juan Linietsky, Ariel Manzur
- Language
- C++
- License
- MIT
- Alternative to
- Unity, Unreal Engine, GameMaker
Use cases
- Indie game development
- 2D games & pixel art
- Game jams
- Interactive simulations
Grafana
DevOps & Infrastructure · Since 2014
The open observability platform — beautiful dashboards over any data source: Prometheus, PostgreSQL, Elasticsearch, cloud services, and more.
- Created by
- Torkel Ödegaard
- Language
- Go / TypeScript
- License
- AGPLv3
- Alternative to
- Kibana, Datadog dashboards
Use cases
- Metrics dashboards
- Log exploration (Loki)
- Business KPI monitoring
- On-call alerting
monitoringdashboardsvisualizationobservability
HAProxy
DevOps & Infrastructure · Since 2001
The reliability workhorse of load balancing — battle-tested TCP/HTTP proxying that fronts some of the highest-traffic sites on the internet.
- Created by
- Willy Tarreau
- Language
- C
- License
- GPLv2
- Alternative to
- Nginx, Envoy, F5 (hardware)
Use cases
- High-traffic load balancing
- TCP proxying (databases)
- Zero-downtime failover
- SSL termination at scale
load-balancingreverse-proxyhigh-availabilitytcp
Helm
DevOps & Infrastructure · Since 2015
The package manager for Kubernetes — bundle complex applications into versioned, configurable charts you can install, upgrade, and roll back with one command.
- Created by
- Matt Butcher, Deis team
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Kustomize, raw manifests, Timoni
Use cases
- Kubernetes app packaging
- Templated deployments per environment
- Third-party software installs
- Release rollbacks
kubernetespackage-managerchartstemplating
Home Assistant
Self-Hosted · Since 2013
The most popular open source smart home platform — control thousands of device brands locally, with privacy-first automation and no cloud lock-in.
- Created by
- Paulus Schoutsen
- Language
- Python
- License
- Apache-2.0
- Alternative to
- Google Home, SmartThings, Homey
Use cases
- Smart home automation
- Local IoT device control
- Energy monitoring
- Privacy-focused home dashboards
smart-homeautomationiotprivacy
Homebrew
Developer Tools · Since 2009
The missing package manager for macOS (and Linux) — 'brew install' anything, from CLI tools to databases to desktop apps, in seconds.
- Created by
- Max Howell
- Language
- Ruby
- License
- BSD-2-Clause
- Alternative to
- MacPorts, Nix, apt (Linux)
Use cases
- Installing developer tools on macOS
- Managing CLI dependencies
- Cask desktop app installs
- Reproducible dev machine setup
package-managermacoscliinstallation
Hono
Web Framework · Since 2022
An ultrafast, lightweight web framework built on Web Standards — the same code runs on Cloudflare Workers, Deno, Bun, Node.js, and every edge runtime.
- Created by
- Yusuke Wada
- Language
- TypeScript
- License
- MIT
- Alternative to
- Express, itty-router
Use cases
- Edge & serverless APIs
- Cloudflare Workers apps
- Runtime-portable backends
- Lightweight middleware stacks
typescriptedgeserverlesslightweight
Hoppscotch
Developer Tools · Since 2019
A lightweight, open source API development ecosystem — test REST, GraphQL, and WebSocket APIs from a fast web app, no account or install required.
- Created by
- Liyas Thomas
- Language
- TypeScript
- License
- MIT
- Alternative to
- Postman, Insomnia, Bruno
Use cases
- API testing & debugging
- GraphQL query building
- WebSocket testing
- Team API collections
api-testinghttp-clientgraphqlwebsockets
htmx
Frontend · Since 2020
Access AJAX, WebSockets, and server-sent events directly from HTML attributes — build modern interfaces with hypermedia instead of a JavaScript framework.
- Created by
- Carson Gross
- Language
- JavaScript
- License
- Zero-Clause BSD (0BSD)
- Alternative to
- React (for server-driven apps), Turbo/Hotwire
Use cases
- Server-rendered interactivity
- Django/Flask/Go frontends
- Avoiding SPA complexity
- Progressive enhancement
html-firsthypermediaajaxno-build
Hugging Face Transformers
AI & Machine Learning · Since 2018
The library that democratized state-of-the-art AI — load thousands of pretrained models (BERT, Llama, Whisper) with a few lines of Python.
- Created by
- Thomas Wolf, Hugging Face
- Language
- Python
- License
- Apache-2.0
- Alternative to
- Raw PyTorch/TF implementations
Use cases
- Using pretrained LLMs
- Fine-tuning models
- Text classification & NER
- Speech & vision models
llmnlppretrained-modelspython
Hugo
Web Framework · Since 2013
The world's fastest static site generator — builds thousands of Markdown pages in milliseconds from a single Go binary with no dependencies.
- Created by
- Steve Francia
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Jekyll, Astro, Eleventy
Use cases
- Documentation sites
- Blogs from Markdown
- Landing pages
- Massive content sites (fast builds)
static-sitegomarkdownperformance
Immich
Self-Hosted · Since 2022
A self-hosted Google Photos replacement that actually rivals it — automatic mobile backup, face recognition, and ML-powered search on your own server.
- Created by
- Alex Tran
- Language
- TypeScript
- License
- AGPLv3
- Alternative to
- Google Photos, iCloud Photos, PhotoPrism
Use cases
- Private photo backup
- Family photo libraries
- Face & object search
- Escaping cloud photo storage fees
photosbackupmachine-learningprivacy
InfluxDB
Database · Since 2013
A purpose-built time-series database for metrics, events, and sensor data — high-throughput ingestion with time-aware queries and retention policies.
- Created by
- Paul Dix
- Language
- Rust / Go
- License
- MIT / Apache-2.0
- Alternative to
- TimescaleDB, Prometheus (long-term), QuestDB
Use cases
- IoT sensor data
- Infrastructure metrics
- Real-time monitoring
- Industrial telemetry
time-seriesmetricsiotmonitoring
Inkscape
Creative & Media · Since 2003
Professional vector graphics editing built on the SVG standard — illustrations, logos, diagrams, and print designs with a fully open toolchain.
- Created by
- Inkscape team (Sodipodi fork)
- Language
- C++
- License
- GPLv2+
- Alternative to
- Adobe Illustrator, Affinity Designer, Figma (vector)
Use cases
- Logo & icon design
- SVG editing for the web
- Print & poster design
- Laser cutter & plotter files
vector-graphicssvgillustrationdesign
Build mobile apps with web technology — a UI toolkit of native-feeling components plus Capacitor to access camera, GPS, and other device APIs.
- Created by
- Max Lynch, Ben Sperry, Adam Bradley
- Language
- TypeScript
- License
- MIT
- Alternative to
- React Native, Flutter
Use cases
- Hybrid mobile apps
- Web-to-mobile ports
- PWAs with native feel
- Angular/React/Vue mobile UIs
hybrid-appsweb-componentscross-platformcapacitor
Istio
DevOps & Infrastructure · Since 2017
The leading Kubernetes service mesh — transparent mutual TLS, traffic shifting, retries, and deep observability between microservices without code changes.
- Created by
- Google, IBM, Lyft
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Linkerd, Cilium Service Mesh, Consul Connect
Use cases
- Zero-trust service-to-service mTLS
- Canary & traffic splitting
- Microservice observability
- Multi-cluster networking
service-meshkubernetesmtlstraffic-management
JAX
AI & Machine Learning · Since 2018
Google's composable machine learning framework — NumPy-compatible APIs with automatic differentiation and XLA compilation to GPUs and TPUs.
- Created by
- Matthew Johnson, Roy Frostig, Google
- Language
- Python
- License
- Apache-2.0
- Alternative to
- PyTorch, TensorFlow
Use cases
- ML research
- Large-scale model training (TPUs)
- Scientific computing
- Differentiable programming
numerical-computingautodiffgpuresearch
Jekyll
Web Framework · Since 2008
The static site generator that started the movement — transform Markdown into websites, with free hosting built into GitHub Pages.
- Created by
- Tom Preston-Werner
- Language
- Ruby
- License
- MIT
- Alternative to
- Hugo, Eleventy, Astro
Use cases
- GitHub Pages sites
- Project documentation
- Personal blogs
- Simple marketing sites
static-siterubymarkdowngithub-pages
Jellyfin
Self-Hosted · Since 2018
The free software media server — stream your movies, shows, and music to any device with no subscriptions, tracking, or artificial paywalls.
- Created by
- Jellyfin community (Emby fork)
- Language
- C#
- License
- GPLv2
- Alternative to
- Plex, Emby
Use cases
- Personal Netflix for your media
- Home media streaming
- Music library serving
- Live TV & DVR
media-serverstreamingno-subscriptionprivacy
Jenkins
DevOps & Infrastructure · Since 2011
The original open source automation server — nearly two decades of CI/CD with 1,800+ plugins integrating virtually every tool in existence.
- Created by
- Kohsuke Kawaguchi
- Language
- Java
- License
- MIT
- Alternative to
- GitHub Actions, GitLab CI, CircleCI
Use cases
- CI/CD pipelines
- Scheduled build automation
- Enterprise on-prem CI
- Complex multi-stage deployments
ci-cdautomationpipelinesplugins
Joplin
Office & Productivity · Since 2017
A privacy-first note-taking app with Markdown, notebooks, and end-to-end encrypted sync to your own storage — Evernote without the lock-in.
- Created by
- Laurent Cozic
- Language
- TypeScript
- License
- AGPLv3
- Alternative to
- Evernote, Notion (notes), Obsidian (proprietary)
Use cases
- Personal knowledge base
- Encrypted cross-device notes
- Web clipping
- Markdown journaling
Jupyter
Data Science · Since 2015
Interactive notebooks that mix live code, visualizations, and narrative text — the default environment for data exploration and ML experimentation.
- Created by
- Fernando Pérez, Brian Granger
- Language
- Python
- License
- BSD-3-Clause
- Alternative to
- Google Colab (hosted), Marimo, RStudio
Use cases
- Data exploration
- ML experiments
- Teaching & tutorials
- Reproducible research
notebookspythoninteractive-computingeducation
Keras
AI & Machine Learning · Since 2015
The human-friendly deep learning API — build and train neural networks in a few readable lines, running on top of JAX, TensorFlow, or PyTorch.
- Created by
- François Chollet
- Language
- Python
- License
- Apache-2.0
- Alternative to
- Raw PyTorch/TensorFlow APIs, fastai
Use cases
- Rapid model prototyping
- Teaching deep learning
- Multi-backend training
- Transfer learning
deep-learningpythonhigh-level-apineural-networks
Keycloak
Security · Since 2014
An identity and access management server — single sign-on, OAuth 2.0, OIDC, SAML, user federation, and social login without writing auth code.
- Created by
- Bill Burke, Stian Thorgersen, Red Hat
- Language
- Java
- License
- Apache-2.0
- Alternative to
- Auth0, Okta, Authentik
Use cases
- Enterprise single sign-on
- OAuth/OIDC provider
- LDAP/AD federation
- Multi-app centralized auth
identityssooauthauthentication
Krita
Creative & Media · Since 2004
A professional digital painting studio built by artists for artists — brush engines, stabilizers, and 2D animation tools rivaling paid suites.
- Created by
- KDE community
- Language
- C++
- License
- GPLv3
- Alternative to
- Photoshop (painting), Clip Studio Paint, Procreate
Use cases
- Digital painting & illustration
- Concept art
- Comics & manga
- 2D frame animation
digital-paintingillustrationanimationart
Kubernetes
DevOps & Infrastructure · Since 2014
The container orchestration system born from Google's internal Borg — automated deployment, scaling, and self-healing for containerized workloads.
- Created by
- Joe Beda, Brendan Burns, Craig McLuckie, Google
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Docker Swarm, Nomad, ECS
Use cases
- Container orchestration at scale
- Multi-cloud deployments
- Self-healing infrastructure
- Platform engineering
containersorchestrationcloud-nativescaling
LangChain
AI & Machine Learning · Since 2022
A framework for building LLM applications — chains, agents, tool calling, and retrieval-augmented generation with pluggable model providers.
- Created by
- Harrison Chase
- Language
- Python
- License
- MIT
- Alternative to
- LlamaIndex, Haystack, direct SDK calls
Use cases
- RAG applications
- AI agents & tool use
- Chatbots over private data
- LLM workflow orchestration
llmagentsragorchestration
Laravel
Web Framework · Since 2011
The most popular PHP framework, loved for its expressive syntax, Eloquent ORM, queues, and a rich first-party ecosystem (Forge, Vapor, Livewire).
- Created by
- Taylor Otwell
- Language
- PHP
- License
- MIT
- Alternative to
- Symfony, Django, Ruby on Rails
Use cases
- SaaS applications
- E-commerce backends
- Business web apps
- API backends
phpormfullstackbatteries-included
LibreOffice
Office & Productivity · Since 2011
The leading open source office suite — Writer, Calc, and Impress with strong Microsoft Office compatibility and the open ODF standard at its core.
- Created by
- The Document Foundation (OpenOffice.org fork)
- Language
- C++
- License
- MPL-2.0
- Alternative to
- Microsoft Office, Google Docs, OnlyOffice
Use cases
- Documents & spreadsheets
- License-free office deployments
- Government open standards
- Headless document conversion
office-suitedocumentsspreadsheetsopen-standards
Linux
Operating System · Since 1991
The kernel that runs the modern world — nearly every server, all of Android, every supercomputer in the Top500, and most embedded devices.
- Created by
- Linus Torvalds
- Language
- C
- License
- GPLv2
- Alternative to
- Windows Server, BSD variants
Use cases
- Cloud & web servers
- Android devices
- Embedded systems & IoT
- Developer workstations
kernelunixserversembedded
llama.cpp
AI & Machine Learning · Since 2023
Pure C/C++ LLM inference with no dependencies — the quantization engine (GGUF) that made running large language models on laptops and phones possible.
- Created by
- Georgi Gerganov
- Language
- C++
- License
- MIT
- Alternative to
- GPU-only inference stacks
Use cases
- CPU/edge LLM inference
- Model quantization (GGUF)
- Embedded AI
- Foundation for Ollama & LM Studio
llminferencequantizationlocal-ai
LlamaIndex
AI & Machine Learning · Since 2022
The data framework for LLM applications — connect language models to your documents, databases, and APIs with production-grade RAG pipelines.
- Created by
- Jerry Liu
- Language
- Python
- License
- MIT
- Alternative to
- LangChain, Haystack
Use cases
- RAG over private documents
- Structured data extraction
- Document agents
- Knowledge assistants
llmragdata-frameworkagents
MariaDB
Database · Since 2009
The community-driven fork of MySQL created by MySQL's original author after the Oracle acquisition — a drop-in replacement that stays truly open.
- Created by
- Michael Widenius
- Language
- C++
- License
- GPLv2
- Alternative to
- MySQL, PostgreSQL
Use cases
- MySQL drop-in replacement
- Web application databases
- Default DB on many Linux distros
- Galera cluster replication
sqlrelationalmysql-compatiblecommunity
Mastodon
Communication & Social · Since 2016
Decentralized social networking — thousands of independently run servers federate through ActivityPub into one network no company controls.
- Created by
- Eugen Rochko
- Language
- Ruby
- License
- AGPLv3
- Alternative to
- Twitter/X, Bluesky, Threads
Use cases
- Community-run social networks
- Ad-free public discourse
- Organization-owned social presence
- Fediverse participation
social-networkfederationactivitypubdecentralized
Matplotlib
Data Science · Since 2003
The grandfather of Python plotting — publication-quality figures with fine-grained control, and the foundation seaborn and pandas plotting build on.
- Created by
- John D. Hunter
- Language
- Python
- License
- Matplotlib License (PSF-based)
- Alternative to
- Plotly, seaborn (higher-level), Bokeh
Use cases
- Scientific publication figures
- Exploratory data plots
- Custom chart control
- Backend for seaborn/pandas
visualizationpythonplottingscientific
Mattermost
Communication & Social · Since 2015
A self-hosted team collaboration platform — Slack-style channels, calls, and playbooks with full data ownership, popular in security-conscious orgs.
- Created by
- Ian Tien, Corey Hulen
- Language
- Go / TypeScript
- License
- MIT (open core)
- Alternative to
- Slack, Microsoft Teams, Rocket.Chat
Use cases
- Self-hosted team chat
- Air-gapped collaboration
- DevOps incident channels
- Compliance-bound messaging
team-chatself-hostedcollaborationdevops
MediaWiki
CMS · Since 2002
The wiki engine that runs Wikipedia — collaborative editing, revision history, and templating proven at the scale of the world's largest knowledge base.
- Created by
- Magnus Manske, Lee Daniel Crocker, Wikimedia
- Language
- PHP
- License
- GPLv2+
- Alternative to
- Confluence, BookStack, Wiki.js
Use cases
- Internal knowledge bases
- Public wikis
- Documentation with history
- Community encyclopedias
wikiphpknowledge-basecollaboration
Meilisearch
Database · Since 2018
A lightning-fast, typo-tolerant search engine that delivers as-you-type results with minimal configuration — search that just works out of the box.
- Created by
- Quentin de Quelen, Clément Renault
- Language
- Rust
- License
- MIT
- Alternative to
- Algolia, Elasticsearch (simple search), Typesense
Use cases
- Site & app search bars
- E-commerce product search
- Documentation search
- Hybrid semantic search
searchtypo-toleranceinstant-searchrust
Metabase
Data Science · Since 2015
The friendliest open source BI tool — non-technical teammates answer their own data questions with a point-and-click query builder in minutes.
- Created by
- Sameer Al-Sakran
- Language
- Clojure
- License
- AGPLv3 (core)
- Alternative to
- Superset, Looker, PowerBI
Use cases
- Team-wide self-serve analytics
- Startup KPI dashboards
- Embedded customer analytics
- Quick database exploration
business-intelligencedashboardsno-codeself-hosted
Metasploit Framework
Security · Since 2003
The standard framework for authorized penetration testing — a modular platform security professionals use to validate vulnerabilities and test defenses.
- Created by
- H.D. Moore
- Language
- Ruby
- License
- BSD-3-Clause
- Alternative to
- Cobalt Strike (commercial), manual exploit research
Use cases
- Authorized penetration tests
- Vulnerability validation
- Security training (CTF)
- Defense testing
penetration-testingsecurity-researchexploitsred-team
MinIO
DevOps & Infrastructure · Since 2014
High-performance, S3-compatible object storage you can run anywhere — the standard way to get an S3 API on your own hardware or private cloud.
- Created by
- Anand Babu Periasamy
- Language
- Go
- License
- AGPLv3
- Alternative to
- AWS S3, Ceph, SeaweedFS
Use cases
- Self-hosted S3 storage
- AI/ML data lakes
- Backup targets
- On-prem cloud storage
object-storages3-compatibleself-hostedcloud-storage
MongoDB
Database · Since 2009
The leading document database — stores flexible JSON-like documents instead of rows, with built-in sharding and replication for horizontal scale.
- Created by
- Dwight Merriman, Eliot Horowitz, 10gen
- Language
- C++
- License
- SSPL (source-available)
- Alternative to
- PostgreSQL JSONB, CouchDB, DynamoDB
Use cases
- Flexible-schema apps
- Content management
- Real-time analytics
- Mobile app backends
nosqldocument-storejsonhorizontal-scaling
MySQL
Database · Since 1995
The database that powered the LAMP stack era and still runs a huge share of the web, including WordPress sites, Facebook, and YouTube's metadata.
- Created by
- Michael Widenius, David Axmark
- Language
- C++
- License
- GPLv2 (dual-licensed)
- Alternative to
- PostgreSQL, MariaDB
Use cases
- Web application backends
- WordPress & CMS databases
- Read-heavy workloads with replicas
- E-commerce
sqlrelationallamp-stackreplication
n8n
Self-Hosted · Since 2019
A workflow automation platform with 400+ integrations and native AI agent nodes — visual automation you can self-host, with code when you need it.
- Created by
- Jan Oberhauser
- Language
- TypeScript
- License
- Sustainable Use License (fair-code)
- Alternative to
- Zapier, Make, Activepieces
Use cases
- Business process automation
- API-to-API integrations
- AI agent workflows
- Self-hosted Zapier replacement
workflow-automationno-codeintegrationsai-agents
Neo4j
Database · Since 2007
The leading graph database — stores data as nodes and relationships and queries them with Cypher, making connected-data questions natural.
- Created by
- Emil Eifrem
- Language
- Java
- License
- GPLv3 (Community Edition)
- Alternative to
- ArangoDB, Amazon Neptune, Memgraph
Use cases
- Recommendation engines
- Fraud detection networks
- Knowledge graphs & GraphRAG
- Identity & access graphs
graph-databasecypherrelationshipsnosql
NestJS
Web Framework · Since 2017
A progressive Node.js framework with Angular-inspired architecture — decorators, modules, and dependency injection for scalable, testable server applications.
- Created by
- Kamil Myśliwiec
- Language
- TypeScript
- License
- MIT
- Alternative to
- Express, Spring Boot (for Node teams)
Use cases
- Enterprise Node.js backends
- Microservices (gRPC, Kafka)
- GraphQL APIs
- Structured team codebases
typescriptnodejsenterprisedependency-injection
Next.js
Web Framework · Since 2016
The React framework for production — server-side rendering, static generation, API routes, and file-based routing in one integrated toolchain.
- Created by
- Guillermo Rauch, Vercel
- Language
- TypeScript
- License
- MIT
- Alternative to
- Remix, Nuxt, Gatsby
Use cases
- SEO-friendly websites
- Full-stack React apps
- E-commerce storefronts
- Marketing sites & blogs
reacttypescriptssrfullstack
Nextcloud
Self-Hosted · Since 2016
The self-hosted content collaboration platform — file sync, calendars, contacts, video calls, and office editing under your own roof and rules.
- Created by
- Frank Karlitschek
- Language
- PHP
- License
- AGPLv3
- Alternative to
- Google Workspace, Dropbox, OneDrive
Use cases
- Private Dropbox/Google Drive
- Team file collaboration
- Self-hosted calendars & contacts
- GDPR-compliant file sharing
file-synccollaborationprivacygroupware
Nginx
DevOps & Infrastructure · Since 2004
A high-performance web server, reverse proxy, and load balancer designed to solve the C10K problem — it now serves more sites than any other web server.
- Created by
- Igor Sysoev
- Language
- C
- License
- BSD-2-Clause
- Alternative to
- Apache HTTP Server, Caddy, Traefik
Use cases
- Reverse proxy for apps
- Static file serving
- Load balancing
- TLS termination
web-serverreverse-proxyload-balancingperformance
Nmap
Security · Since 1997
The network mapper — the standard tool for host discovery, port scanning, and service fingerprinting, used by sysadmins and security teams since 1997.
- Created by
- Gordon Lyon (Fyodor)
- Language
- C / C++ / Lua
- License
- NPSL (Nmap Public Source License)
- Alternative to
- Masscan, RustScan
Use cases
- Network inventory & discovery
- Security auditing
- Open port verification
- Firewall rule testing
network-scanningsecurity-auditingdiscoverypentesting
Node.js
Runtime · Since 2009
The JavaScript runtime built on Chrome's V8 engine that brought JS to the server, with an event-driven, non-blocking I/O model and the npm ecosystem.
- Created by
- Ryan Dahl
- Language
- C++ / JavaScript
- License
- MIT
- Alternative to
- Bun, Deno
Use cases
- Backend services & APIs
- Build tooling
- Real-time apps (websockets)
- CLI tools
javascriptruntimeevent-drivenbackend
NumPy
Data Science · Since 2006
The foundation of the Python scientific stack — fast N-dimensional arrays and vectorized math that pandas, scikit-learn, and PyTorch all build upon.
- Created by
- Travis Oliphant
- Language
- C / Python
- License
- BSD-3-Clause
- Alternative to
- MATLAB matrices, Julia arrays
Use cases
- Numerical computation
- Linear algebra
- Signal & image processing
- Scientific simulation
pythonarraysnumerical-computingscientific
Nuxt
Web Framework · Since 2016
The intuitive Vue framework — server-side rendering, file-based routing, and auto-imports that make full-stack Vue applications feel effortless.
- Created by
- Sébastien Chopin, Alexandre Chopin
- Language
- TypeScript
- License
- MIT
- Alternative to
- Next.js (for Vue teams), SvelteKit
Use cases
- SEO-friendly Vue apps
- Full-stack Vue development
- Static site generation
- E-commerce frontends
vuetypescriptssrfullstack
OBS Studio
Creative & Media · Since 2012
The free streaming and recording studio behind most of Twitch and YouTube Live — scene composition, mixing, and encoding with zero cost.
- Created by
- Hugh Bailey
- Language
- C / C++
- License
- GPLv2
- Alternative to
- Streamlabs (built on OBS), vMix, Wirecast
Use cases
- Live streaming (Twitch/YouTube)
- Screen recording & tutorials
- Webinar production
- Virtual camera effects
streamingrecordingbroadcastingvideo-production
Odoo
Self-Hosted · Since 2005
A full suite of open source business apps — CRM, accounting, inventory, HR, e-commerce, and manufacturing that share one integrated database.
- Created by
- Fabien Pinckaers
- Language
- Python
- License
- LGPLv3 (Community Edition)
- Alternative to
- SAP (SME), NetSuite, ERPNext
Use cases
- SME ERP systems
- Inventory & manufacturing
- CRM & sales pipelines
- Integrated accounting
erpcrmbusiness-appsaccounting
Ollama
AI & Machine Learning · Since 2023
Run large language models locally with one command — pulls quantized models like Llama and Gemma and serves them through a simple REST API.
- Created by
- Jeffrey Morgan, Michael Chiang
- Language
- Go
- License
- MIT
- Alternative to
- llama.cpp (direct), LM Studio, cloud LLM APIs
Use cases
- Local LLM inference
- Private AI assistants
- Offline development
- Prototyping without API costs
llmlocal-aiself-hostedinference
OpenCV
AI & Machine Learning · Since 2000
The foundational computer vision library — 2,500+ algorithms for image processing, object detection, and video analysis, born at Intel in 2000.
- Created by
- Gary Bradski, Intel
- Language
- C++
- License
- Apache-2.0
- Alternative to
- scikit-image, PIL/Pillow (basic)
Use cases
- Object & face detection
- Video analysis
- Robotics vision
- Image preprocessing for ML
computer-visionimage-processingvideoc++
OpenSSL
Security · Since 1998
The cryptography library that secures most of the internet — TLS/SSL implementation and crypto primitives embedded in servers, browsers, and devices everywhere.
- Created by
- Eric A. Young, Tim Hudson (SSLeay origins)
- Language
- C
- License
- Apache-2.0
- Alternative to
- BoringSSL, LibreSSL, rustls
Use cases
- TLS for web servers
- Certificate generation & inspection
- Encryption in applications
- Crypto tooling (CLI)
cryptographytlscertificatesencryption
OpenTelemetry
DevOps & Infrastructure · Since 2019
The vendor-neutral observability standard — one set of APIs and SDKs for traces, metrics, and logs that exports to any backend, from Jaeger to Datadog.
- Created by
- CNCF community (OpenTracing + OpenCensus merger)
- Language
- Go (collector) / multi-language SDKs
- License
- Apache-2.0
- Alternative to
- Proprietary APM agents
Use cases
- Distributed tracing
- Vendor-neutral instrumentation
- Unified telemetry pipelines
- Avoiding observability lock-in
observabilitytracingmetricsvendor-neutral
OpenTofu
DevOps & Infrastructure · Since 2023
The Linux Foundation's open source fork of Terraform, created after HashiCorp's license change — declarative infrastructure-as-code that stays truly open.
- Created by
- OpenTofu community, Linux Foundation
- Language
- Go
- License
- MPL-2.0
- Alternative to
- Terraform, Pulumi, CloudFormation
Use cases
- Cloud infrastructure provisioning
- Multi-cloud IaC
- Terraform migration
- State-managed deployments
infrastructure-as-codecloudprovisioningterraform-compatible
Pandas
Data Science · Since 2008
The Python data analysis library built around the DataFrame — loading, cleaning, transforming, and analyzing tabular data is its home turf.
- Created by
- Wes McKinney
- Language
- Python
- License
- BSD-3-Clause
- Alternative to
- Polars, DuckDB, Excel
Use cases
- Data cleaning & wrangling
- Exploratory analysis
- ETL scripts
- Time-series analysis
pythondataframesdata-analysisetl
A code-first headless CMS that installs directly into your Next.js app — config as TypeScript, giving developers full control and editors a polished admin UI.
- Created by
- James Mikrut
- Language
- TypeScript
- License
- MIT
- Alternative to
- Strapi, Sanity, Contentful
Use cases
- Next.js-native CMS
- Type-safe content APIs
- Custom admin panels
- E-commerce backends
headless-cmstypescriptnextjscode-first
Penpot
Creative & Media · Since 2021
The open source design and prototyping platform — Figma-style collaborative design built on open standards (SVG/CSS), self-hostable by your team.
- Created by
- Pablo Ruiz-Múzquiz, Kaleidos
- Language
- Clojure / ClojureScript
- License
- MPL-2.0
- Alternative to
- Figma, Sketch, Adobe XD
Use cases
- UI/UX design
- Interactive prototypes
- Design systems with code tokens
- Self-hosted design collaboration
designprototypingsvgcollaboration
Phoenix
Web Framework · Since 2014
The Elixir web framework built on the Erlang VM — LiveView delivers rich, real-time UIs from the server with almost no custom JavaScript.
- Created by
- Chris McCord
- Language
- Elixir
- License
- MIT
- Alternative to
- Rails, Django, Next.js (for realtime)
Use cases
- Real-time web apps (LiveView)
- Chat & collaboration tools
- High-concurrency APIs
- Fault-tolerant web services
elixirrealtimeliveviewwebsockets
Pi-hole
Self-Hosted · Since 2015
A network-wide ad blocker that works as a DNS sinkhole — block ads and trackers for every device on your network, including smart TVs and phones.
- Created by
- Jacob Salmela
- Language
- Shell / PHP
- License
- EUPL-1.2
- Alternative to
- AdGuard Home, NextDNS
Use cases
- Network-wide ad blocking
- DNS-level tracker blocking
- Home network monitoring
- Parental DNS filtering
dnsad-blockingnetworkraspberry-pi
PocketBase
Self-Hosted · Since 2022
An entire backend in a single executable file — SQLite database, realtime subscriptions, auth, and file storage with an admin UI, zero dependencies.
- Created by
- Gani Georgiev
- Language
- Go
- License
- MIT
- Alternative to
- Firebase, Supabase, Appwrite
Use cases
- Side project backends
- Prototype APIs in minutes
- Small production apps
- Embedded Go framework
baassqlitesingle-binaryrealtime
Podman
DevOps & Infrastructure · Since 2018
A daemonless, rootless container engine with a Docker-compatible CLI — run containers without a privileged background service, alias docker=podman and go.
- Created by
- Red Hat (Daniel Walsh team)
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Docker, containerd/nerdctl
Use cases
- Rootless container security
- Docker replacement on Linux
- Systemd-managed containers
- Kubernetes-compatible pods locally
containersdaemonlessrootlessdocker-compatible
Polars
Data Science · Since 2020
A lightning-fast DataFrame library written in Rust — multi-threaded, memory-efficient, with lazy query optimization that routinely beats pandas by 10-100x.
- Created by
- Ritchie Vink
- Language
- Rust
- License
- MIT
- Alternative to
- Pandas, Dask, DuckDB
Use cases
- Fast data wrangling
- Larger-than-pandas datasets
- ETL transforms
- Lazy query pipelines
dataframesrustperformancelazy-evaluation
PostgreSQL
Database · Since 1996
The world's most advanced open source relational database — rock-solid ACID compliance, JSON support, full-text search, and an extension ecosystem (PostGIS, pgvector).
- Created by
- Michael Stonebraker, UC Berkeley POSTGRES team
- Language
- C
- License
- PostgreSQL License
- Alternative to
- MySQL, Oracle, SQL Server
Use cases
- Application databases
- Geospatial data (PostGIS)
- Vector search for AI (pgvector)
- Analytics workloads
sqlrelationalacidextensions
Preact
Frontend · Since 2015
A fast 3kB alternative to React with the same modern API — drop-in compatible via preact/compat, ideal when every kilobyte counts.
- Created by
- Jason Miller
- Language
- JavaScript
- License
- MIT
- Alternative to
- React
Use cases
- Performance-critical widgets
- Embedded components
- Progressive web apps
- React apps needing smaller bundles
javascriptlightweightreact-compatibleperformance
Prettier
Developer Tools · Since 2017
The opinionated code formatter that ended style debates — one consistent format for JS, TS, CSS, HTML, and Markdown, applied automatically on save.
- Created by
- James Long
- Language
- JavaScript
- License
- MIT
- Alternative to
- Biome, dprint, manual style guides
Use cases
- Automatic code formatting
- Consistent team style
- Format-on-save workflows
- Pre-commit formatting
formattingcode-stylejavascriptopinionated
Prometheus
DevOps & Infrastructure · Since 2012
The de facto standard for cloud-native monitoring — a pull-based time-series database with the PromQL query language and built-in alerting.
- Created by
- Julius Volz, Matt T. Proud, SoundCloud
- Language
- Go
- License
- Apache-2.0
- Alternative to
- Datadog (self-hosted), InfluxDB, VictoriaMetrics
Use cases
- Infrastructure monitoring
- Kubernetes metrics
- SLO alerting
- Application instrumentation
monitoringmetricstime-seriesalerting
PyTorch
AI & Machine Learning · Since 2016
The dominant deep learning framework in research — dynamic computation graphs, Pythonic APIs, and the foundation under most modern LLMs.
- Created by
- Adam Paszke, Soumith Chintala, Meta AI
- Language
- C++ / Python
- License
- BSD-3-Clause
- Alternative to
- TensorFlow, JAX
Use cases
- LLM training & fine-tuning
- Research prototyping
- Computer vision
- Production inference (TorchServe)
deep-learningpythonneural-networksresearch
RabbitMQ
DevOps & Infrastructure · Since 2007
The most widely deployed open source message broker — reliable queuing, flexible routing, and delivery guarantees over AMQP, MQTT, and STOMP.
- Created by
- Alexis Richardson, Matthias Radestock, Rabbit Technologies
- Language
- Erlang
- License
- MPL-2.0
- Alternative to
- Apache Kafka (queuing), Redis queues, NATS
Use cases
- Task queues & background jobs
- Microservice messaging
- Request buffering
- IoT message routing (MQTT)
message-brokeramqpqueuesevent-driven
React
Frontend · Since 2013
A JavaScript library for building user interfaces with reusable components and a declarative programming model. The most widely used frontend library in the world.
- Created by
- Jordan Walke, Meta
- Language
- JavaScript
- License
- MIT
- Alternative to
- Angular, Vue.js
Use cases
- Single-page applications
- Interactive dashboards
- Design systems
- Cross-platform apps (React Native)
javascriptui-librarycomponentsspa
React Native
Mobile · Since 2015
Build native mobile apps with React — JavaScript drives real platform UI components, sharing logic (and developers) with your web codebase.
- Created by
- Meta
- Language
- JavaScript / C++
- License
- MIT
- Alternative to
- Flutter, native development
Use cases
- iOS & Android apps from one codebase
- Web-team mobile apps
- Rapid mobile iteration (Expo)
- Brownfield native integration
reactjavascriptcross-platformnative-components
Redis
Database · Since 2009
An in-memory data structure store used as a cache, message broker, and database — sub-millisecond reads with strings, hashes, sorted sets, and streams.
- Created by
- Salvatore Sanfilippo
- Language
- C
- License
- AGPLv3 (since 8.0)
- Alternative to
- Valkey, Memcached
Use cases
- Application caching
- Session storage
- Rate limiting
- Queues & pub/sub
in-memorykey-valuecachingpub-sub
Redux
Frontend · Since 2015
The predictable state container that defined frontend state management — a single store, pure reducers, and time-travel debugging, modernized by Redux Toolkit.
- Created by
- Dan Abramov, Andrew Clark
- Language
- TypeScript
- License
- MIT
- Alternative to
- Zustand, MobX, Jotai
Use cases
- Complex app state
- Predictable state debugging
- Large team state conventions
- RTK Query data fetching
state-managementjavascriptpredictabledevtools
Remix
Web Framework · Since 2021
A full-stack React framework centered on web standards — loaders, actions, and progressive enhancement built on the Fetch API, now converging with React Router.
- Created by
- Ryan Florence, Michael Jackson
- Language
- TypeScript
- License
- MIT
- Alternative to
- Next.js, SvelteKit
Use cases
- Full-stack React apps
- Forms-heavy applications
- E-commerce (Shopify Hydrogen)
- Progressive enhancement
reactssrweb-standardsfullstack
ripgrep
Developer Tools · Since 2016
A line-oriented search tool that recursively searches directories at astonishing speed — respects .gitignore by default and powers VS Code's search.
- Created by
- Andrew Gallant (BurntSushi)
- Language
- Rust
- License
- MIT / Unlicense
- Alternative to
- grep, ag (The Silver Searcher), ack
Use cases
- Codebase searching
- Editor search backends
- Log file grepping
- Scripted text processing
Ruby on Rails
Web Framework · Since 2004
The framework that defined convention-over-configuration and made one-person web apps possible. GitHub, Shopify, and Basecamp still run on Rails.
- Created by
- David Heinemeier Hansson
- Language
- Ruby
- License
- MIT
- Alternative to
- Django, Laravel
Use cases
- Startup MVPs
- SaaS products
- Marketplaces
- Internal tools
rubyormfullstackconvention-over-configuration
scikit-learn
AI & Machine Learning · Since 2007
The standard library for classical machine learning in Python — regression, classification, clustering, and model evaluation with a famously consistent API.
- Created by
- David Cournapeau
- Language
- Python
- License
- BSD-3-Clause
- Alternative to
- XGBoost (boosting), statsmodels
Use cases
- Predictive modeling
- Feature engineering pipelines
- Model evaluation
- Teaching ML fundamentals
machine-learningpythonclassical-mldata-science
Signal
Communication & Social · Since 2014
The gold standard of private messaging — the Signal Protocol's end-to-end encryption is so good that WhatsApp and Google adopted it too.
- Created by
- Moxie Marlinspike, Open Whisper Systems
- Language
- Rust / Java / Swift
- License
- AGPLv3
- Alternative to
- WhatsApp, Telegram, iMessage
Use cases
- Private personal messaging
- Encrypted voice & video calls
- Journalist & activist comms
- Disappearing messages
messagingend-to-end-encryptionprivacyprotocol
SolidJS
Frontend · Since 2018
A declarative UI library with React-like JSX but fine-grained reactivity instead of a virtual DOM — components run once and updates are surgical.
- Created by
- Ryan Carniato
- Language
- TypeScript
- License
- MIT
- Alternative to
- React, Svelte
Use cases
- High-performance UIs
- Dashboards with frequent updates
- Apps where bundle size matters
- Full-stack (SolidStart)
javascriptreactivityperformancejsx
spaCy
AI & Machine Learning · Since 2015
Industrial-strength natural language processing — fast tokenization, named entity recognition, and dependency parsing designed for production, not papers.
- Created by
- Matthew Honnibal, Ines Montani
- Language
- Python
- License
- MIT
- Alternative to
- NLTK, Stanza, Transformers (heavier)
Use cases
- Named entity recognition
- Text preprocessing pipelines
- Information extraction
- Document classification
nlppythonproductiontext-processing
Spring Boot
Web Framework · Since 2014
Opinionated auto-configuration on top of the Spring framework that turns Java enterprise development into runnable, production-ready services in minutes.
- Created by
- Phil Webb, Dave Syer, Pivotal
- Language
- Java
- License
- Apache-2.0
- Alternative to
- Quarkus, Micronaut, .NET
Use cases
- Enterprise microservices
- Banking & fintech backends
- REST APIs
- Batch processing
javaenterprisemicroservicesdependency-injection
SQLite
Database · Since 2000
A self-contained, serverless SQL database in a single file — the most deployed database engine on Earth, embedded in every phone, browser, and OS.
- Created by
- D. Richard Hipp
- Language
- C
- License
- Public Domain
- Alternative to
- File-based storage, DuckDB (analytics)
Use cases
- Mobile & desktop app storage
- Embedded devices
- Local-first apps
- Testing & prototyping
sqlembeddedserverlesszero-config
Storybook
Developer Tools · Since 2016
A workshop for building UI components in isolation — develop, document, and visually test components outside your app across React, Vue, Angular, and more.
- Created by
- Arunoda Susiripala
- Language
- TypeScript
- License
- MIT
- Alternative to
- Ladle, Histoire
Use cases
- Component-driven development
- Design system documentation
- Visual regression testing
- Team component catalogs
ui-componentsdocumentationtestingdesign-systems
The leading open source headless CMS — design content types in an admin panel and instantly get REST and GraphQL APIs for any frontend.
- Created by
- Pierre Burgy, Aurélien Georget, Jim Laurie
- Language
- TypeScript
- License
- MIT (with EE edition)
- Alternative to
- Contentful, Sanity, Payload
Use cases
- Headless content for Next.js/mobile
- Multi-channel publishing
- Editorial admin panels
- Rapid API backends
headless-cmsnodejsapi-firstjavascript
Streamlit
Data Science · Since 2019
Turn Python scripts into shareable web apps in minutes — no frontend knowledge needed, just write Python and get interactive widgets and charts.
- Created by
- Adrien Treuille, Amanda Kelly, Thiago Teixeira
- Language
- Python
- License
- Apache-2.0
- Alternative to
- Gradio, Dash, Panel
Use cases
- ML demo apps
- Internal data tools
- Model prototyping UIs
- Interactive reports
pythondata-appsdashboardsprototyping
Supabase
Database · Since 2020
An open source Firebase alternative built on PostgreSQL — instant APIs, authentication, realtime subscriptions, storage, and edge functions from one dashboard.
- Created by
- Paul Copplestone, Ant Wilson
- Language
- TypeScript
- License
- Apache-2.0
- Alternative to
- Firebase, AWS Amplify
Use cases
- Backend-as-a-service
- Auth & user management
- Realtime apps
- Rapid MVP backends
postgresqlbaasrealtimeauth
Svelte
Frontend · Since 2016
A radical framework that compiles your components to minimal vanilla JavaScript at build time — no virtual DOM, tiny bundles, and famously pleasant syntax.
- Created by
- Rich Harris
- Language
- JavaScript
- License
- MIT
- Alternative to
- React, Vue.js
Use cases
- Fast, lightweight web apps
- Interactive data visualizations
- Embedded widgets
- Full-stack apps (SvelteKit)
javascriptcompilerui-libraryspa
Symfony
Web Framework · Since 2005
A mature PHP framework and a set of reusable components that many other projects — including Laravel and Drupal — are built on.
- Created by
- Fabien Potencier
- Language
- PHP
- License
- MIT
- Alternative to
- Laravel, Laminas
Use cases
- Enterprise PHP applications
- Long-lived maintainable codebases
- API platforms
- Reusable component foundation
phpcomponentsenterprisemvc
Tailwind CSS
Frontend · Since 2017
A utility-first CSS framework that lets you style directly in your markup with composable classes instead of writing custom CSS files.
- Created by
- Adam Wathan, Steve Schoger
- Language
- TypeScript
- License
- MIT
- Alternative to
- Bootstrap, custom CSS
Use cases
- Rapid UI development
- Design systems
- Responsive layouts
- Component libraries (shadcn/ui)
cssutility-firstdesignbuild-tool
Tauri
Desktop · Since 2019
Build tiny, fast desktop and mobile apps with a Rust core and the OS's native webview — apps often 10x smaller and lighter than Electron equivalents.
- Created by
- Daniel Thompson-Yvetot, Lucas Nogueira
- Language
- Rust
- License
- MIT / Apache-2.0
- Alternative to
- Electron, Wails, Neutralino
Use cases
- Lightweight desktop apps
- Security-focused app shells
- Rust + web frontend apps
- Cross-platform including mobile
desktop-appsrustlightweightwebview
TensorFlow
AI & Machine Learning · Since 2015
Google's end-to-end machine learning platform — from research with Keras to production serving, mobile deployment (LiteRT), and browser inference (TF.js).
- Created by
- Google Brain team
- Language
- C++ / Python
- License
- Apache-2.0
- Alternative to
- PyTorch, JAX
Use cases
- Deep learning models
- Production ML pipelines
- On-device inference
- Computer vision & NLP
deep-learningpythonneural-networksproduction-ml
Three.js
Frontend · Since 2010
The standard JavaScript library for 3D graphics in the browser — a friendly API over WebGL/WebGPU powering product configurators, games, and creative sites.
- Created by
- Ricardo Cabello (Mr.doob)
- Language
- JavaScript
- License
- MIT
- Alternative to
- Babylon.js, raw WebGL
Use cases
- 3D product showcases
- Browser games
- Data visualization in 3D
- Creative & portfolio sites
tmux
Developer Tools · Since 2007
The terminal multiplexer — split panes, persistent sessions that survive disconnects, and scriptable layouts for serious terminal work.
- Created by
- Nicholas Marriott
- Language
- C
- License
- ISC
- Alternative to
- GNU Screen, Zellij, terminal tabs
Use cases
- Persistent SSH sessions
- Split-pane terminal workflows
- Remote pair programming
- Long-running job monitoring
terminalmultiplexersessionscli
Traefik
DevOps & Infrastructure · Since 2015
A cloud-native reverse proxy that configures itself — watches Docker and Kubernetes and automatically routes traffic to new services with Let's Encrypt TLS.
- Created by
- Emile Vauge
- Language
- Go
- License
- MIT
- Alternative to
- Nginx, Caddy, HAProxy
Use cases
- Docker & Kubernetes ingress
- Automatic HTTPS certificates
- Home lab reverse proxy
- Dynamic service routing
reverse-proxyload-balancingauto-discoverycloud-native
Typesense
Database · Since 2018
An open source, typo-tolerant search engine optimized for sub-50ms instant search experiences — a batteries-included Algolia alternative.
- Created by
- Kishore Nallan, Jason Bosco
- Language
- C++
- License
- GPLv3
- Alternative to
- Algolia, Meilisearch, Elasticsearch
Use cases
- Instant site search
- E-commerce faceted search
- Geo-search
- Vector & semantic search
searchinstant-searchtypo-tolerancein-memory
Uptime Kuma
Self-Hosted · Since 2021
A fancy self-hosted uptime monitor — beautiful dashboards, 90+ notification channels, and public status pages, all in one lightweight container.
- Created by
- Louis Lam
- Language
- JavaScript
- License
- MIT
- Alternative to
- UptimeRobot, Pingdom, StatusCake
Use cases
- Website uptime monitoring
- Public status pages
- Home lab service checks
- SSL expiry alerts
monitoringuptimestatus-pagenotifications
Valkey
Database · Since 2024
The Linux Foundation's community fork of Redis, created when Redis changed licenses in 2024 — fully open, drop-in compatible, and backed by AWS and Google.
- Created by
- Redis community contributors, Linux Foundation
- Language
- C
- License
- BSD-3-Clause
- Alternative to
- Redis, Memcached, KeyDB
Use cases
- Redis drop-in replacement
- Caching & session storage
- Pub/sub messaging
- Rate limiting
in-memorykey-valuecachingredis-compatible
Vaultwarden
Self-Hosted · Since 2018
A lightweight, Bitwarden-compatible password manager server in Rust — all premium features, self-hosted, running comfortably on a Raspberry Pi.
- Created by
- Daniel García
- Language
- Rust
- License
- AGPLv3
- Alternative to
- Bitwarden Cloud, 1Password, LastPass
Use cases
- Self-hosted password vault
- Family password sharing
- Home lab secrets
- Bitwarden clients with your server
password-managerrustbitwarden-compatibleprivacy
Visual Studio Code
Developer Tools · Since 2015
Microsoft's free, extensible code editor — IntelliSense, integrated debugging, Git support, and a marketplace of over 60,000 extensions.
- Created by
- Erich Gamma, Microsoft
- Language
- TypeScript
- License
- MIT (code) / Microsoft license (binaries)
- Alternative to
- JetBrains IDEs, Neovim, Zed
Use cases
- Everyday code editing
- Remote & container development
- Debugging
- Notebook editing
editortypescriptextensionsdebugging
Vite
Developer Tools · Since 2020
A next-generation frontend build tool with instant dev server startup via native ES modules and lightning-fast hot module replacement.
- Created by
- Evan You
- Language
- TypeScript
- License
- MIT
- Alternative to
- webpack, Parcel, esbuild (direct)
Use cases
- Frontend dev servers
- Production bundling (Rollup)
- Framework tooling (Vue, React, Svelte)
- Library builds
build-toolbundlerjavascripthmr
VLC Media Player
Creative & Media · Since 2001
The media player that plays everything — no codec packs, no ads, no tracking, on every platform, with billions of downloads worldwide.
- Created by
- VideoLAN project (École Centrale Paris students)
- Language
- C
- License
- GPLv2 / LGPLv2.1
- Alternative to
- mpv, Windows Media Player, QuickTime
Use cases
- Universal media playback
- Network stream viewing
- Media conversion
- DVD/Blu-ray playback
media-playercodecsstreamingcross-platform
vLLM
AI & Machine Learning · Since 2023
A high-throughput LLM serving engine from UC Berkeley — PagedAttention memory management delivers up to 24x more throughput than naive serving.
- Created by
- Woosuk Kwon, Zhuohan Li, UC Berkeley Sky Computing Lab
- Language
- Python
- License
- Apache-2.0
- Alternative to
- TGI (Text Generation Inference), SGLang, TensorRT-LLM
Use cases
- Production LLM serving
- High-throughput batch inference
- OpenAI-compatible API hosting
- Multi-GPU model deployment
Vue.js
Frontend · Since 2014
A progressive JavaScript framework that is approachable for beginners yet scales to complex single-page applications through its official router and state libraries.
- Created by
- Evan You
- Language
- TypeScript
- License
- MIT
- Alternative to
- React, Angular
Use cases
- Single-page applications
- Progressive enhancement of existing pages
- Admin panels
- Prototyping
javascripttypescriptui-libraryspa
Whisper
AI & Machine Learning · Since 2022
OpenAI's open-sourced speech recognition model — robust transcription and translation across ~100 languages, trained on 680,000 hours of audio.
- Created by
- OpenAI
- Language
- Python
- License
- MIT
- Alternative to
- Google Speech-to-Text, AssemblyAI, Deepgram
Use cases
- Audio & video transcription
- Subtitle generation
- Voice interfaces
- Meeting notes automation
speech-recognitiontranscriptionmultilingualaudio
WireGuard
Security · Since 2016
A modern VPN protocol in ~4,000 lines of code — dramatically simpler and faster than OpenVPN and IPsec, now built into the Linux kernel.
- Created by
- Jason A. Donenfeld
- Language
- C
- License
- GPLv2
- Alternative to
- OpenVPN, IPsec
Use cases
- Site-to-site VPNs
- Remote access to home labs
- Mesh networks (Tailscale base)
- Mobile VPN connections
vpnnetworkingencryptionkernel
Wireshark
Security · Since 1998
The world's foremost network protocol analyzer — capture and inspect traffic packet by packet across 3,000+ protocols, essential for network debugging.
- Created by
- Gerald Combs
- Language
- C / C++
- License
- GPLv2
- Alternative to
- tcpdump (GUI), Fiddler
Use cases
- Network troubleshooting
- Protocol analysis & learning
- Security investigations
- API traffic debugging
network-analysispacket-capturedebuggingprotocols
WordPress
CMS · Since 2003
The CMS that runs over 40% of the web — a plugin and theme ecosystem so deep that everything from blogs to e-commerce stores is a few clicks away.
- Created by
- Matt Mullenweg, Mike Little
- Language
- PHP
- License
- GPLv2
- Alternative to
- Ghost, Drupal, Wix (proprietary)
Use cases
- Blogs & content sites
- Small business websites
- E-commerce (WooCommerce)
- Headless CMS via REST API
XGBoost
AI & Machine Learning · Since 2014
The gradient boosting library that dominated Kaggle for a decade — still the go-to for tabular data where deep learning underperforms.
- Created by
- Tianqi Chen
- Language
- C++
- License
- Apache-2.0
- Alternative to
- LightGBM, CatBoost, scikit-learn GBM
Use cases
- Tabular prediction models
- Credit scoring & risk
- Ranking systems
- ML competitions
gradient-boostingtabular-datakagglemachine-learning
Zod
Developer Tools · Since 2020
TypeScript-first schema validation with static type inference — define a schema once and get both runtime validation and compile-time types.
- Created by
- Colin McDonnell
- Language
- TypeScript
- License
- MIT
- Alternative to
- Yup, Valibot, Joi
Use cases
- API input validation
- Form validation
- Environment variable checking
- Type-safe data parsing
validationtypescriptschemastype-safety